IGF-1 LR3 1mg
£49.99
IGF-1 LR3 (insulin-like growth factor-1 long arginine 3) is a synthetic, modified construct of insulin-like growth factor-1. Because IGF-1 LR3 does not bind to IGF-1 binding proteins very well, it remains active up to 120 times longer than standard IGF-1. This results in an improved half-life for the peptide and thus increased activity.
Fast Shipping
Most orders are shipped out within 1-2 working days.
Secure Payment
We guarantee that the payments are 100% secure.
Research Use Only
Our peptides are intended for research use only.
Description
Long arginine 3-IGF-1 (IGF-1 LR3), offered at 1mg, is a high-quality specialised research peptide developed for advanced scientific exploration in biochemistry and related fields. This product is ideal for laboratory settings where precision and reliability are paramount.
- Product Name: IGF LR3 1mg
- Catalogue Number: IGF1LR3-1mg
- Molecular Weight: 9117.60 gmol
- Purity: ≥98%
- Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
- Form: Lyophilised Solid
Usage and Storage
Long arginine 3-IGF-1 (IGF-1 LR3) is supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. For best results, follow our website’s detailed reconstitution and storage guidelines.
Synthesis and Quality Assurance
Long arginine 3-IGF-1 (IGF-1 LR3) is meticulously synthesised through a controlled process that guarantees high purity (≥98%) and stability, making it suitable for precise scientific studies. Our commitment to excellence ensures that each batch undergoes stringent quality control to meet the rigorous standards researchers require.
Legal and Safety Information
XL-Peptides proudly provides Long arginine 3-IGF-1 (IGF-1 LR3) strictly for scientific and research use. In alignment with our dedication to supporting the research community, we ensure our products meet stringent quality standards and legal requirements. Please note that our peptides, including Long arginine 3-IGF-1 (IGF-1 LR3), are not designed for human consumption or clinical application.
If you require high-quality Long arginine 3-IGF-1 (IGF-1 LR3) for your research in the UK, explore our range of peptides designed for scientific rigour and innovation.
XL Peptides works with various third-party laboratories to provide testing reports for all its manufactured products.
| Date | Batch No | Issuing Lab | Lab Report | View QR |
|---|---|---|---|---|
| 21-Jan-25 | 007001 |  | View Report |  |
To find out more about our testing policy, please visit our Testing page.
Reviews
There are no reviews yet.